PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Vun002440
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Vigna
Family MYB
Protein Properties Length: 303aa    MW: 34357.6 Da    PI: 7.0342
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-167a-Vigna_unguiculata-32782PU_refplantGDBView CDS
gnl|UG|Vun#S45803200PU_unrefUnigeneView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding612.5e-191461148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g+W++eEd++lvd+++++G g+W++ ++  g++R++k+c++rw +yl
        Vun002440 14 KGPWSPEEDKILVDYIQKHGHGSWRALPKLAGLNRCGKSCRLRWTNYL 61
                     79********************************************97 PP

2Myb_DNA-binding50.16.1e-1667112148
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                      rg+++ +E++l++++++ lG++ W++Ia++++ gRt++++k+ w+++l
        Vun002440  67 RGKFSDQEEQLIINLHAVLGNK-WAAIASHLP-GRTDNEIKNLWNTHL 112
                      89********************.*********.************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129417.629961IPR017930Myb domain
SuperFamilySSF466891.98E-3111108IPR009057Homeodomain-like
SMARTSM007171.7E-151363IPR001005SANT/Myb domain
PfamPF002498.8E-181461IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.608.6E-251568IPR009057Homeodomain-like
CDDcd001676.19E-121661No hitNo description
PROSITE profilePS5129425.67262116IPR017930Myb domain
SMARTSM007172.1E-1466114IPR001005SANT/Myb domain
PfamPF002495.6E-1567112IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.5E-2669116IPR009057Homeodomain-like
CDDcd001671.25E-1069112No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 303 aa     Download sequence    Send to blast
MMRTPSSDES GLKKGPWSPE EDKILVDYIQ KHGHGSWRAL PKLAGLNRCG KSCRLRWTNY  60
LRPDIKRGKF SDQEEQLIIN LHAVLGNKWA AIASHLPGRT DNEIKNLWNT HLRKKLLQMG  120
LDPVTHRPRT DHLNLLTNLQ QILAAAKIVS TLTNPSDINN VLRLHSDAKF QLLQNMFQLT  180
PSSNSFLPLN SLTDGFMNHC NNDLPNLLHD GNSVSEIHPN FQNFEALHHP TQENSLPNLV  240
SASPERSPLK EAENVNANSK ECSNPSSTTF ELAWGDFMDE DATENYWKGF IDQHCNQTWS  300
TVQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-281211625128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014520504.10.0PREDICTED: transcription repressor MYB6-like
TrEMBLA0A0S3T6680.0A0A0S3T668_PHAAN; Uncharacterized protein
STRINGGLYMA01G44370.21e-150(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16770.21e-97myb domain protein 9